PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00289
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 335aa    MW: 37392 Da    PI: 5.8174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00289genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++ v+++G  +W++ +r  g++R++k+c++rw +yl
       AA44G00289 14 KGPWTPEEDEKLINHVQKHGHSSWRALPRLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.13.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ ++++++ lG++ W+tIa++++ gRt++++k++w+++l
       AA44G00289  67 RGKFSGDEEQTILNLHAVLGNK-WSTIANHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-25664IPR009057Homeodomain-like
PROSITE profilePS5129418.419961IPR017930Myb domain
SuperFamilySSF466892.81E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002493.2E-171461IPR001005SANT/Myb domain
CDDcd001671.72E-121661No hitNo description
PROSITE profilePS5129425.48262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-2765117IPR009057Homeodomain-like
SMARTSM007173.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001673.29E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRSPSSDDS GLKKGPWTPE EDEKLINHVQ KHGHSSWRAL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SGDEEQTILN LHAVLGNKWS TIANHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSNLSQLM SLSNLSGLVD LQQQFPIDDQ TLLKLQTEMA KLQLFQYLLQ  180
PLSLNNINPN DLDTLNLLLN SISSIKGNTN TSNLDLSSYL QDLNSLPSLK ALDCNLQSSA  240
VFPENSDENL FKFFNQRESI PMSPLWLSEP SSSTHPSLDL SAVTGDLIRN PYEVEDVGSN  300
INTSISQESS AAAAAAASAA WPDHLLDDSL FSDIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196590.11e-179myb domain protein 92
SwissprotQ8GWP02e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLQ9SBF31e-178Q9SBF3_ARATH; MYB transcription factor
STRINGAT5G10280.11e-178(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-153myb domain protein 92